PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G069400.2
Common NamePHAVU_007G069400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 322aa    MW: 36113.7 Da    PI: 7.581
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G069400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21.1e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEd+ lvd++k++G g+W+t +++ g+ R++k+c++rw +yl
  Phvul.007G069400.2 14 RGAWTPEEDQALVDYIKEHGHGSWRTLPKHAGLLRCGKSCRLRWINYL 61
                        89******************************99************97 PP

2Myb_DNA-binding53.84.4e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T eE+  +v+++ +lG++ W++Ia+ ++ gRt++++k++w+++l
  Phvul.007G069400.2  67 RGPFTSEEESTIVQLHGMLGNR-WAAIASQLP-GRTDNEIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.401961IPR017930Myb domain
SuperFamilySSF466894.03E-3111108IPR009057Homeodomain-like
SMARTSM007176.3E-151363IPR001005SANT/Myb domain
PfamPF002493.2E-171461IPR001005SANT/Myb domain
CDDcd001677.16E-121661No hitNo description
PROSITE profilePS5129425.27262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2665116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567112IPR001005SANT/Myb domain
CDDcd001675.01E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGKAPCCEKH GVKRGAWTPE EDQALVDYIK EHGHGSWRTL PKHAGLLRCG KSCRLRWINY  60
LRPGIKRGPF TSEEESTIVQ LHGMLGNRWA AIASQLPGRT DNEIKNYWNT HLKKRLLRSC  120
HSLREKQSCL ILDQTIVKSE SPSTRHMVQW ESVRVEAEAR LSMESSLLNS WPTSTTCPDH  180
FLHLWNSEVG KSFRMVKGKE GVVSQSPISH LSFSSKLESC SDVSVQVKNN GTSRLNPRIE  240
DVNMVPEQIS SYKPKLDDTT GSDSGNYEFL DTSDSALKHL LHMSDGDVGF LGQNDNFLNL  300
LDATCDQDSF FHISSSEKGN L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143400.10.0hypothetical protein PHAVU_007G069400g
RefseqXP_007143401.10.0hypothetical protein PHAVU_007G069400g
TrEMBLV7BCT80.0V7BCT8_PHAVU; Uncharacterized protein
STRINGGLYMA10G38090.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.17e-94myb domain protein 17